PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.118200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 148aa    MW: 16379.3 Da    PI: 9.0615
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.118200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.43.4e-3479136259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYY+Cts++C+vkk+vers+edp++v++tYeg+Hnh 
  Cucsa.118200.1  79 EDGYRWRKYGQKAVKNSPFPRSYYKCTSQNCSVKKRVERSSEDPSFVITTYEGKHNHY 136
                     8********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-3565136IPR003657WRKY domain
SuperFamilySSF1182901.11E-2971138IPR003657WRKY domain
PROSITE profilePS5081132.29473138IPR003657WRKY domain
SMARTSM007744.8E-3978137IPR003657WRKY domain
PfamPF031062.0E-2779135IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MSCSSSEVIC SVDDALKKSS SLGRDLSSVV TGEHPSTPNC SSTTCSSDEV VAGGGKKKEK  60
REKGPRFAFL TKTEIDNLED GYRWRKYGQK AVKNSPFPRS YYKCTSQNCS VKKRVERSSE  120
DPSFVITTYE GKHNHYCPIT LRGHNPTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-30711381077Probable WRKY transcription factor 4
2lex_A5e-30711381077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819211e-65LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039.
GenBankLN7132651e-65LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011656990.11e-85PREDICTED: probable WRKY transcription factor 12
SwissprotQ8VWJ21e-42WRK28_ARATH; Probable WRKY transcription factor 28
SwissprotQ93WV41e-42WRK71_ARATH; Probable WRKY transcription factor 71
TrEMBLA0A0A0KBC52e-85A0A0A0KBC5_CUCSA; Uncharacterized protein
STRINGVIT_12s0028g00270.t016e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2467333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.19e-44WRKY DNA-binding protein 71